PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.FH8XF
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family B3
Protein Properties Length: 482aa    MW: 56178.5 Da    PI: 10.8338
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.FH8XFgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.31.8e-1521112198
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  ffkv +++    ++ + lpkkf++++g+    s  l l+ ++g +W+v+   ++++gr+++++GWkeFv    L++g ++ F ++   + +  v++f+
  Araip.FH8XF  21 FFKVILRKTLQDEN-FKLPKKFTRKYGSG--LSNPLYLKPPDGTEWRVNW--TNHDGRTLFKRGWKEFVAYYSLDDGHVLWFDYNI-GTSHIEVQIFD 112
                  66777666555555.***********755..6667***************..*******************************973.44445888876 PP

2B344.43e-142763571599
                  -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                    ++p kf++++ ++++++  +++     + + vkliyr +s+  ++++GW+ F++a +L++gD+++Fkl++r++  l v+++r+
  Araip.FH8XF 276 PCYFPTKFFRKYFENNPQNANIRFG---KKLFPVKLIYRPSSCYAFISAGWNFFARASKLQAGDVCLFKLVNRKDPVLDVHICRR 357
                  3589********7777788788855...59*****************************************999999******98 PP

3B349.67.3e-163974791298
                  HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  +++r  l+  f +++ +k++++  ++l+    + W v++iy+ +s+ +++++GW++F++a +L++gD++vF+l+++++  ++v+++r
  Araip.FH8XF 397 RRSRPNLSAIFYRKYFKKNQQN--VKLQ-FGKELWPVTIIYNPSSRNTFISAGWSSFARASKLEAGDVCVFELINKKDL-FNVHICR 479
                  4556778888999997665554..5543.35589****************************************87444.69*9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.1E-1915114IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.63E-1815114IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.33720114IPR003340B3 DNA binding domain
CDDcd100171.54E-1220112No hitNo description
SMARTSM010195.3E-1021114IPR003340B3 DNA binding domain
PfamPF023621.5E-1221112IPR003340B3 DNA binding domain
SuperFamilySSF1019367.46E-13257357IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.0E-15259357IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.22262358IPR003340B3 DNA binding domain
SMARTSM010197.9E-6263358IPR003340B3 DNA binding domain
PfamPF023628.6E-13276358IPR003340B3 DNA binding domain
CDDcd100171.19E-10278356No hitNo description
Gene3DG3DSA:2.40.330.101.7E-20379481IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.1E-18380481IPR015300DNA-binding pseudobarrel domain
CDDcd100171.05E-15385479No hitNo description
SMARTSM010194.1E-13387481IPR003340B3 DNA binding domain
PfamPF023627.0E-14401480IPR003340B3 DNA binding domain
PROSITE profilePS5086311.293428481IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MASSNGQQNK YSPSSSTMIR FFKVILRKTL QDENFKLPKK FTRKYGSGLS NPLYLKPPDG  60
TEWRVNWTNH DGRTLFKRGW KEFVAYYSLD DGHVLWFDYN IGTSHIEVQI FDMSGLQIEY  120
PANDQIKEHP PQHRVQPVER PKEQQTRDVD SSPNTQNLRL NEGRQKKRLN EPLLGGVQGQ  180
SRKKLRAPVS SASKGRQLEN DTQIKEGIRF KKKNHKKTVS VNQDSNGKRN RRRKDSESSV  240
RPYPARPESL KEAKKFKWEK PSFIIKIKQL SQTKAPCYFP TKFFRKYFEN NPQNANIRFG  300
KKLFPVKLIY RPSSCYAFIS AGWNFFARAS KLQAGDVCLF KLVNRKDPVL DVHICRRQRR  360
ESLSKPVTHG IQLLKEVKEL NSQNPSFMVK IKDSDPRRSR PNLSAIFYRK YFKKNQQNVK  420
LQFGKELWPV TIIYNPSSRN TFISAGWSSF ARASKLEAGD VCVFELINKK DLFNVHICRV  480
KC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016179782.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15597210
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-24B3 family protein